PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P06000_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 392aa    MW: 43053.2 Da    PI: 6.2435
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P06000_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox22.81.5e-073333662154
                             HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             k +yp+++++++L +++gL+ +q+ +WF N+R +
  GSMUA_Achr10P06000_001 333 KWPYPTEDDKARLVQETGLQLKQINNWFINQRKR 366
                             469*****************************87 PP

2ELK28.92.5e-10287308122
                     ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                             ELKh+L+++Y+++++++++E++
  GSMUA_Achr10P06000_001 287 ELKHELKQGYKEKIVDIREEIL 308
                             9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012558.3E-19122166IPR005540KNOX1
PfamPF037903.7E-17124164IPR005540KNOX1
SMARTSM012567.1E-26175230IPR005541KNOX2
PfamPF037911.1E-18180229IPR005541KNOX2
SMARTSM011886.1E-4287308IPR005539ELK domain
PROSITE profilePS512139.969287307IPR005539ELK domain
PfamPF037899.0E-7287308IPR005539ELK domain
PROSITE profilePS5007111.548307370IPR001356Homeobox domain
SuperFamilySSF466895.99E-16309374IPR009057Homeodomain-like
SMARTSM003895.2E-11309374IPR001356Homeobox domain
CDDcd000861.24E-11310369No hitNo description
Gene3DG3DSA:1.10.10.604.5E-25314371IPR009057Homeodomain-like
PfamPF059202.8E-17327366IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MAFRGRIPRE LTLPQYAEQH LTDDHAVIGS VDPLSGPAEP SVEPQHAPLV SAGGSDGIGP  60
AWLGGAALRP QGPRGSFLHL QTASDSSASP GGRGGGGQWL PRLPGSGDGE AAEVGEGTWR  120
SARYKAEILA HPLYEQLLSA HVACLRIATP VDQLPRIDTQ LAQTQHIVSK YSALGAQMLA  180
DDKELDQFMT QYVLLLRSFK EQLQQHVRVH AMEAVMACWE LEQSLQSLTG VSPGEGTGAT  240
MSDDDDDQAD SETNLFDGCL DGSDGMGFGP LFLTESEKTL MERVRQELKH ELKQGYKEKI  300
VDIREEILRK RRAGKLPGDT TSTLKAWWQS HSKWPYPTED DKARLVQETG LQLKQINNWF  360
INQRKRNWHS NPSSSSSTKS KRKSNAGDKG QL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1x2n_A5e-13310374872Homeobox protein PKNOX1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19096GGRGGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2261961e-167AC226196.1 Musa acuminata clone BAC MA4-125A12, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009420367.10.0PREDICTED: homeobox protein knotted-1-like 13 isoform X1
SwissprotP480001e-171KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLM0RFS70.0M0RFS7_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P06000_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56438169
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.11e-159KNOTTED1-like homeobox gene 3